PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_10190951g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 146aa    MW: 17314.9 Da    PI: 11.1077
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_10190951g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.48e-142875148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT +Ed +l++++ + G g+W   a+  g++Rt+k+c++rw +yl
  MA_10190951g0010 28 KGPWTVQEDMQLIRYISLQGEGRWPYLAKAAGLKRTGKSCRLRWINYL 75
                      79********************************************97 PP

2Myb_DNA-binding51.22.9e-1681124146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       r + T+eE+ l+++++ ++G++ W++Ia+ ++ gRt++++k++w++
  MA_10190951g0010  81 RSKITPEEERLIIKLHGRWGNR-WSRIAQNLP-GRTDNEIKNYWRT 124
                       6788******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.0552375IPR017930Myb domain
SuperFamilySSF466891.91E-2926122IPR009057Homeodomain-like
SMARTSM007172.5E-112777IPR001005SANT/Myb domain
PfamPF002493.0E-122875IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-222982IPR009057Homeodomain-like
CDDcd001671.47E-73075No hitNo description
PROSITE profilePS5129425.4576130IPR017930Myb domain
SMARTSM007175.9E-1580128IPR001005SANT/Myb domain
PfamPF002498.7E-1582124IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-2483130IPR009057Homeodomain-like
CDDcd001671.60E-1085124No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 146 aa     Download sequence    Send to blast
MLWSANFMAL RNWWEFSAVE HEQPQTRKGP WTVQEDMQLI RYISLQGEGR WPYLAKAAGL  60
KRTGKSCRLR WINYLRPDLK RSKITPEEER LIIKLHGRWG NRWSRIAQNL PGRTDNEIKN  120
YWRTRIKKRL NLQAETGSSG MDAGSM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-282413023128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012483815.14e-56PREDICTED: myb-related protein 305-like
SwissprotP813912e-55MYB05_ANTMA; Myb-related protein 305
TrEMBLA0A0C9RMW56e-60A0A0C9RMW5_9SPER; TSA: Wollemia nobilis Ref_Wollemi_Transcript_9986_1363 transcribed RNA sequence
TrEMBLA0A0D6QR059e-60A0A0D6QR05_ARACU; Uncharacterized protein
STRINGGLYMA05G08690.11e-53(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27810.11e-54myb domain protein 21